Sermorelin
Pulsatile GH Secretion & Axis-Preserving Growth Hormone Stimulation
Sermorelin — GHRH(1-29)NH₂ Growth Hormone-Releasing Hormone Analog
Last reviewed: August 2026
Sermorelin is a shortened version of the hormone your brain uses to tell your pituitary gland to make growth hormone. It's 29 amino acids long — just the active fragment of the full 44-amino-acid signal — and it was FDA-approved for treating growth hormone deficiency in children under the brand name Geref®.
Instead of injecting growth hormone directly, sermorelin tells your pituitary gland to make its own. This is a meaningful distinction: when you inject GH directly, your body gets a large, non-pulsatile dose that bypasses its normal feedback systems. Sermorelin works upstream — it rings the doorbell and lets the pituitary decide how much GH to release, which means the body's natural checks and balances stay intact. In research models, this produces a more physiological GH pulse pattern.
Growth hormone is released in pulses, with the largest pulse occurring shortly after sleep onset. Sermorelin's short half-life (~10–20 minutes) makes it well-suited to amplify this natural sleep pulse when timed appropriately. Researchers studying GH deficiency, body composition, sleep quality, and age-related GH decline have used sermorelin as a tool to study axis-preserving GH stimulation.
Sermorelin is one of the most established GHRH analogs in research, with a clinical history in pediatric GH deficiency and a well-characterized safety profile. Its axis-preserving mechanism and short half-life make it a distinct option compared to longer-acting analogs like CJC-1295 DAC or tesamorelin. All research-grade sermorelin from Purgo Labs is for laboratory use only.
What is Sermorelin?
Sermorelin is a synthetic analog of endogenous growth hormone-releasing hormone (GHRH) comprising the biologically active N-terminal 29 amino acids of the 44-residue native peptide. This truncated fragment retains full receptor-binding activity at the GHRH receptor (GHRHR) on pituitary somatotrophs while offering improved synthetic accessibility and a well-characterized pharmacokinetic profile.
Unlike exogenous growth hormone administration, sermorelin stimulates the pituitary to produce and secrete GH through its own endogenous feedback mechanisms. This axis-preserving mechanism maintains the pulsatile pattern of GH release, preserves hypothalamic-pituitary-axis (HPA) negative feedback, and avoids the supraphysiological GH levels associated with direct GH injection. Sermorelin was previously FDA-approved under the brand name Geref® for the diagnosis and treatment of growth hormone deficiency in children, providing a meaningful clinical safety dataset.
- Sermorelin is the biologically active N-terminal 29-amino acid fragment of endogenous GHRH (1-44), binding GHRH receptors on pituitary somatotrophs to stimulate pulsatile GH secretion.
- Unlike direct GH administration, sermorelin preserves the hypothalamic-pituitary feedback axis — somatostatin-mediated inhibitory feedback remains intact, maintaining physiological GH pulse architecture.
- FDA-approved as Geref® (1997) for pediatric growth hormone deficiency; voluntarily withdrawn in 2002 for commercial (not safety) reasons, providing a meaningful clinical safety foundation.
- Short half-life (~10–20 min) makes bedtime administration optimal — amplifies the natural sleep-onset GH pulse rather than creating off-cycle, non-physiological GH elevation.
- Compared to CJC-1295 DAC (half-life ~6–8 days) and tesamorelin (FDA-approved for visceral fat), sermorelin offers the most physiological GH pulse pattern with the longest safety history.
Molecular Composition
Sermorelin consists of the first 29 amino acids of the 44-residue human GHRH sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg (YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQER). The C-terminus is amidated in the acetate salt form (sermorelin acetate), which is the standard research-grade formulation.
With a molecular weight of 3,357.9 Da, sermorelin is substantially smaller than full-length GHRH (5,040 Da) and tesamorelin (5,135.9 Da), making it more cost-effective to synthesize at high purity. The N-terminal tyrosine residue is critical for GHRHR binding; modifications at this position substantially reduce biological activity.
How Does It Work?
Sermorelin stimulates pulsatile growth hormone release by mimicking the brain's GHRH signal at the pituitary, preserving the body's natural GH feedback axis.
Sermorelin binds to the GHRH receptor (GHRHR), a Gs-coupled GPCR expressed on anterior pituitary somatotroph cells. Receptor activation stimulates adenylyl cyclase, elevating intracellular cAMP and activating protein kinase A (PKA). PKA phosphorylates downstream targets that promote both GH synthesis (via CREB-mediated transcription of the GH gene) and GH secretion (via calcium-dependent exocytosis of GH-containing secretory granules).
Because sermorelin acts upstream of the pituitary, GH release remains subject to normal somatostatin-mediated inhibition and physiological negative feedback from circulating IGF-1. This preserves the pulsatile, amplitude-modulated pattern of GH secretion that characterizes normal physiology — a key mechanistic distinction from exogenous GH or longer-acting GHRH analogs like CJC-1295 DAC, which can blunt pulsatility through sustained receptor occupancy.
Key Research Pathways
GHRHR / cAMP / PKA Signaling
Binds GHRH receptor on pituitary somatotrophs, activating adenylyl cyclase → cAMP → PKA cascade to stimulate GH synthesis and pulsatile secretion.
GH / IGF-1 Axis Activation
Secreted GH drives hepatic IGF-1 production, mediating downstream anabolic effects on muscle, bone, and metabolism.
Somatostatin Feedback Preservation
Unlike direct GH administration, sermorelin's upstream action preserves somatostatin-mediated inhibitory feedback, maintaining physiological GH pulse architecture.
CREB-Mediated GH Gene Transcription
PKA phosphorylates CREB transcription factor, upregulating GH gene expression in somatotroph cells for sustained GH synthesis.
Key Findings from the Literature
- Previously FDA-approved (Geref®) for GH deficiency diagnosis and treatment in pediatric patients
- Stimulates pulsatile GH release while preserving somatostatin-mediated negative feedback
- Increases serum IGF-1 levels in GH-deficient subjects (Walker et al., 1990)
- Half-life of ~10–20 minutes allows precise dosing windows around sleep-onset GH pulse
- Axis-preserving mechanism avoids pituitary desensitization seen with continuous GHRH exposure
- Studied in adult GH deficiency, body composition, sleep quality, and anti-aging protocols
How Long It Lasts & How It Works in the Body
Sermorelin — half-life, bioavailability, onset, and duration data
| Parameter | Value | Source |
|---|---|---|
| Half-Life (t½) | ~10–20 minutes Very short; requires daily dosing, typically at bedtime | Prescribing Information |
| Time to Peak (Tmax) | ~5–20 minutes Rapid absorption after SC injection | Prescribing Information |
| Bioavailability (F) | Estimated 50–70% (SC) Rapidly degraded by serum proteases | Preclinical Data |
| Onset of Action | Minutes GH pulse begins within minutes of injection | — |
| Duration of Action | 30–60 minutes Short GH pulse; bedtime dosing aligns with natural GH release | — |
Shortest half-life of the GHRH analogs. Bedtime dosing is standard to align with the natural nocturnal GH pulse. Requires daily administration.
References:
• Geref Prescribing Information
• Walker RF. Curr Opin Investig Drugs 2006
Important Research Context
Research References
Peer-reviewed literature supporting the research profile of Sermorelin
The following peer-reviewed studies form the primary evidence base for Sermorelin's research profile. All references are sourced from PubMed, NCBI, and peer-reviewed scientific journals. Published research is available through PubMed, NCBI, and peer-reviewed biomedical journals.
- 1.
Walker RF. Sermorelin: a better approach to management of adult-onset growth hormone insufficiency?. Clinical Interventions in Aging. 2006.PMID: 18046908
Sermorelin restores physiological GH pulsatility and is well-tolerated in adult GH insufficiency.
- 2.
Vittone J, et al. Effects of single nightly injections of growth hormone-releasing hormone (GHRH 1-29) in healthy elderly men. Metabolism. 1997.PMID: 9005976
Nightly sermorelin injections increased IGF-1 and improved body composition in elderly men.
- 3.
Corpas E, Harman SM, Blackman MR. Human growth hormone and human aging. Endocrine Reviews. 1993.PMID: 8491152
Established the rationale for GHRH-based therapies in age-related GH decline.
Sermorelin
Growth Research
Purgo Labs list price, read 12 Sep 2026 · per-lot COA on the vendor page
10mg $47.99 → $38.39 with code HEALTH (20% off; price read 23 Sept 2026)
- 1 certificate verified at the lab10mg$59.99$47.99→ $38.39
- 2 certificates verified at the lab10mg$45.00→ $40.50
- 2 certificates verified at the lab5mg$79.99→ $71.99
Fast FedEx shipping · Discreet packaging
Technical Specifications
| Peptide Class | GHRH analog — N-terminal 29-residue fragment |
| Molecular Weight | 3,357.9 Da |
| Amino Acid Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQER (29 AA) |
| Receptor Target | GHRH receptor (GHRHR) on pituitary somatotrophs |
| Half-Life | ~10–20 minutes (short-acting) |
| Available Sizes | 5mg vials |
| Form | Lyophilized powder |
| Purity | ≥99% (third-party tested) |
Known Interactions
7 documented interactions for Sermorelin
Both are GHRH analogs targeting the same receptor. Combining may cause excessive GH release. Generally use one or the other, not both.
Both increase GH secretion via different mechanisms. Combining may cause excessive GH/IGF-1 elevation.
Both stimulate GH release via complementary pathways. Commonly co-administered in anti-aging protocols.
Sermorelin stimulates GH release; IGF-1 LR3 provides direct anabolic signaling. Complementary.
Interaction data is based on published research, known pharmacological mechanisms, and clinical practitioner experience. Evidence tiers: Clinical = human data; Emerging = preclinical/case reports; Theoretical = mechanism-based inference. Always consult a qualified healthcare provider before combining compounds.
Source Sermorelin at Purgo Labs
10mg $47.99 list · $38.39 with code HEALTH · lab-verifiable COA per lot
Other Compounds in This Guide
Related Research Guides
Supporting Research
Sermorelin has small human pharmacodynamic studies showing GH/IGF-1 elevation and body composition effects in older adults, plus a historical FDA approval for pediatric GH deficiency (withdrawn 2002 for commercial reasons, not safety). No large outcome RCTs exist for anti-aging or body composition endpoints.
References
- Vittone J, et al.HUMAN STUDY, n=16, elderly menEffects of single nightly injections of growth hormone-releasing hormone (GHRH 1-29) in healthy elderly men. Metabolism. 1997. PubMedNightly sermorelin increased IGF-1 and improved body composition in elderly men over 6 months.
- Walker RF.REVIEWSermorelin: a better approach to management of adult-onset growth hormone insufficiency?. Clin Interv Aging. 2006. PubMedSermorelin restores physiological GH pulsatility and is well-tolerated in adult GH insufficiency.
Research Databases
Ready to Source Sermorelin?
Purgo Labs offers Sermorelin with ≥99% purity, third-party certificates of analysis, and fast FedEx shipping. This is an affiliate link — we may earn a commission at no cost to you.